Skip to product information
1 of 1

Gene Bio Systems

Recombinant Atlantic salmon Vertebrate ancient opsin,partial

Recombinant Atlantic salmon Vertebrate ancient opsin,partial

SKU:CSB-EP517517SWI

Regular price $1,332.50 CAD
Regular price Sale price $1,332.50 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: O13018

Gene Names: N/A

Organism: Salmo salar (Atlantic salmon)

AA Sequence: MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN

Expression Region: 1-75aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

MW: 22.5 kDa

Alternative Name(s):

Relevance:

Reference: "A novel and ancient vertebrate opsin." Soni B.G., Foster R.G. FEBS Lett. 406:279-283(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details