Recombinant Atlantic salmon Vertebrate ancient opsin,Partial

Recombinant Atlantic salmon Vertebrate ancient opsin,Partial

CSB-EP517517SWI
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Salmo salar (Atlantic salmon)

Delivery time: 3-7 business days

Uniprot ID: O13018

AA Sequence: MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN

Tag info: N-terminal 6xHis-B2M-tagged

Expression Region: 1-75aa

Protein length: Partial

MW: 22.5 kDa

Alternative Name(s):

Relevance:

Reference: "A novel and ancient vertebrate opsin." Soni B.G., Foster R.G. FEBS Lett. 406:279-283(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share