Gene Bio Systems
Recombinant Aspergillus oryzae Mitochondrial intermembrane space import and assembly protein 40(mia40)
Recombinant Aspergillus oryzae Mitochondrial intermembrane space import and assembly protein 40(mia40)
SKU:CSB-CF650409DPA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Uniprot NO.:Q2USJ2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ISTAPAESKPRSWKNTAVRLGLAAGAIYYYNTSNVFAENPSFSLNNQLKKNSAEEPLPTL DSIKPRIREERESAAPKPNAEQAPAQELPFGEGAVKSPQELEEEAGQEAAFNPETGEINW DCPCLGGMAHGPCGEEFKAAFSCFVYSEEEPKGMDCIEKFKCV
Protein Names:Recommended name: Mitochondrial intermembrane space import and assembly protein 40 Alternative name(s): Mitochondrial import inner membrane translocase TIM40
Gene Names:Name:mia40 Synonyms:tim40 ORF Names:AO090005000405
Expression Region:25-187
Sequence Info:full length protein
