Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D(eglD)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D(eglD)

CSB-YP836318APOa4
Regular price
$1,112.31 CAD
Sale price
$1,112.31 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: Q96WQ9

Gene Names: eglD

Organism: Aspergillus kawachii (strain NBRC 4308)

AA Sequence: HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ

Expression Region: 21-408aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

MW: 55.7 kDa

Alternative Name(s): Carboxymethylcellulase D Cellulase 61A Cellulase D cel61A

Relevance: Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates

Reference: "Genome sequence of the white koji mold Aspergillus kawachii IFO 4308, used for brewing the Japanese distilled spirit shochu." Futagami T., Mori K., Yamashita A., Wada S., Kajiwara Y., Takashita H., Omori T., Takegawa K., Tashiro K., Kuhara S., Goto M. Eukaryot. Cell 10:1586-1587(2011)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share