Recombinant Ashbya gossypii Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDH4)

SKU: CSB-CF744953DOT

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Uniprot NO.:Q750S6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQGIKMASPVIRAACKRSLHQSAVRAITIPFLPTLPQNPGGVKGDVNEANPVPPANKMHG S

Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): Succinate-ubiquinone reductase membrane anchor subunit

Gene Names:Name:SDH4 Ordered Locus Names:AGL137W

Expression Region:1-61

Sequence Info:full length protein