Gene Bio Systems
Recombinant Ashbya gossypii Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit(ERI1)
Recombinant Ashbya gossypii Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit(ERI1)
SKU:CSB-CF748412DOT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Uniprot NO.:Q75D30
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNDKVAATLVLVVTYSIVGASLWCLTYAWHDETKLYYWCIVQLLPVMLWVWCVISWCGAQ LFGYAKRGKAD
Protein Names:Recommended name: Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit Alternative name(s): Endoplasmic reticulum-associated Ras inhibitor protein 1
Gene Names:Name:ERI1 Ordered Locus Names:ABR192C-A
Expression Region:1-71
Sequence Info:full length protein
