Gene Bio Systems
Recombinant Ashbya gossypii Mitochondrial import inner membrane translocase subunit TIM14(PAM18)
Recombinant Ashbya gossypii Mitochondrial import inner membrane translocase subunit TIM14(PAM18)
SKU:CSB-CF762230DOT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Uniprot NO.:Q759D2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAPPTIEIPQLPIPGEDNSAHPAQQIRLEQAAVPQQKRGMDLYFDKVVDFVGEHPVVGGI GGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTESTLTKKRVK DVHRKIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK
Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit TIM14 Alternative name(s): Presequence translocated-associated motor subunit PAM18
Gene Names:Name:PAM18 Synonyms:TIM14 Ordered Locus Names:ADR345C
Expression Region:1-158
Sequence Info:full length protein
