Gene Bio Systems
Recombinant Ashbya gossypii Genetic interactor of prohibitin 7, mitochondrial(GEP7)
Recombinant Ashbya gossypii Genetic interactor of prohibitin 7, mitochondrial(GEP7)
SKU:CSB-CF758786DOT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Uniprot NO.:Q75EB9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SDTVSKLNSGELTEVVRQRYCVDNKDRCETRMLLTKYPGPAREREMLQVATAELSARDWR KMPRVWQQVSYYHAFGSWGPRTGLSFVGRRPEDFFVTDQKGLWTCSAPRRAEYERSSRAL DPASRAVLYAAALVAAVAALGDLWRRQDADRQVTVAELDLAEPTSSPT
Protein Names:Recommended name: Genetic interactor of prohibitin 7, mitochondrial
Gene Names:Name:GEP7 Ordered Locus Names:AAR155W
Expression Region:67-234
Sequence Info:full length protein
