Gene Bio Systems
Recombinant Arthrobacter aurescens UPF0060 membrane protein AAur_4166 (AAur_4166)
Recombinant Arthrobacter aurescens UPF0060 membrane protein AAur_4166 (AAur_4166)
SKU:CSB-CF376801AUZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arthrobacter aurescens (strain TC1)
Uniprot NO.:A1RC71
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTILKTTILFVLAAVAEIGGAWLIWQAVREGKAWWWAGLGVVALGIYGFFAAFQPDAHFG RVLAAYGGVFIAGSLGWGMLMDGFRPDRWDVIGAAICIVGVGVIMFAPRPGG
Protein Names:Recommended name: UPF0060 membrane protein AAur_4166
Gene Names:Ordered Locus Names:AAur_4166
Expression Region:1-112
Sequence Info:full length protein
