
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q84ZX5
Gene Names: N/A
Organism: Artemisia vulgaris (Mugwort)
AA Sequence: AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
Expression Region: 25-132aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 26.8 kDa
Alternative Name(s): Defensin-like protein 1 Allergen: Art v 1
Relevance:
Reference: "Art v 1, the major allergen of mugwort pollen, is a modular glycoprotein with a defensin-like and a hydroxyproline-rich domain."Himly M., Jahn-Schmid B., Dedic A., Kelemen P., Wopfner N., Altmann F., van Ree R., Briza P., Richter K., Ebner C., Ferreira F.FASEB J. 17:106-108(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.