Skip to product information
1 of 1

Gene Bio Systems

Recombinant Artemia salina NADH-ubiquinone oxidoreductase chain 4(ND4)

Recombinant Artemia salina NADH-ubiquinone oxidoreductase chain 4(ND4)

SKU:CSB-CF015079AOE

Regular price $1,974.00 CAD
Regular price Sale price $1,974.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Artemia salina (Brine shrimp)

Uniprot NO.:P19046

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LFVLLWLTFTTQSFILFYVFFECSLIPTIILILGWGYQPERLPASYYFLFYTLLSSLPLL FIIMLTRVFIR

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4

Gene Names:Name:ND4

Expression Region:1-71

Sequence Info:full length protein

View full details