Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arcobacter butzleri UPF0059 membrane protein Abu_0335 (Abu_0335)

Recombinant Arcobacter butzleri UPF0059 membrane protein Abu_0335 (Abu_0335)

SKU:CSB-CF423303AUY

Regular price $2,133.60 CAD
Regular price Sale price $2,133.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arcobacter butzleri (strain RM4018)

Uniprot NO.:A8ERN6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLEVLILAFALSMDAFAVSIGLGIKNKQNLKALALKAGLFFGIFQALMPFLGFLGGIGLR EYIQGYDKIVAFILLLAIGGKMIYEAFNENVEEEISQITNKILLTLAIATSLDAMAAGYS LHLFNLNIYLSLFVIGFTTFIISYIGVYVGSRGGEKYESKAEILGGVVLILIGLKILLF

Protein Names:Recommended name: UPF0059 membrane protein Abu_0335

Gene Names:Ordered Locus Names:Abu_0335

Expression Region:1-179

Sequence Info:full length protein

View full details