Gene Bio Systems
Recombinant Arcobacter butzleri UPF0059 membrane protein Abu_0335 (Abu_0335)
Recombinant Arcobacter butzleri UPF0059 membrane protein Abu_0335 (Abu_0335)
SKU:CSB-CF423303AUY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Arcobacter butzleri (strain RM4018)
Uniprot NO.:A8ERN6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLEVLILAFALSMDAFAVSIGLGIKNKQNLKALALKAGLFFGIFQALMPFLGFLGGIGLR EYIQGYDKIVAFILLLAIGGKMIYEAFNENVEEEISQITNKILLTLAIATSLDAMAAGYS LHLFNLNIYLSLFVIGFTTFIISYIGVYVGSRGGEKYESKAEILGGVVLILIGLKILLF
Protein Names:Recommended name: UPF0059 membrane protein Abu_0335
Gene Names:Ordered Locus Names:Abu_0335
Expression Region:1-179
Sequence Info:full length protein
