Recombinant Archaeoglobus fulgidus  Uncharacterized protein AF_1301 (AF_1301)

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1301 (AF_1301)

CSB-CF518091DOC
Regular price
$1,403.00 CAD
Sale price
$1,403.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Uniprot NO.:O28968

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKTSLSSLQRGLSEIFAFAYRNYALTKNEFYAIFEMLFWPLVSLISVGLLGEFLYLDREA VASY

Protein Names:Recommended name: Uncharacterized protein AF_1301

Gene Names:Ordered Locus Names:AF_1301

Expression Region:1-64

Sequence Info:full length protein

Your list is ready to share