Skip to product information
1 of 1

Gene Bio Systems

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0585 (AF_0585)

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0585 (AF_0585)

SKU:CSB-CF523164DOC

Regular price $2,002.00 CAD
Regular price Sale price $2,002.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Uniprot NO.:O29670

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGDYFDILTLILTAIYLLIGGGFIIYIYDTYKRTKQEFLIYLSIGFFLLIIGASLPVLTF VAQVLDMSVVVVAILMQIAGLSSIFYSIVR

Protein Names:Recommended name: Uncharacterized protein AF_0585

Gene Names:Ordered Locus Names:AF_0585

Expression Region:1-90

Sequence Info:full length protein

View full details