Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Uniprot NO.:O30088
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVFAYVLVSGFMLVLGIKYGRTKIYSVWKAGLIILAGFAVIFAAAWIAFTGTSASQERIG LAKSLSVVMGLIAGVLSVYVLSKS
Protein Names:Recommended name: Uncharacterized protein AF_0149
Gene Names:Ordered Locus Names:AF_0149
Expression Region:1-84
Sequence Info:full length protein