Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Vacuolar iron transporter homolog 4(At3g43660)

Recombinant Arabidopsis thaliana Vacuolar iron transporter homolog 4(At3g43660)

SKU:CSB-CF888900DOA

Regular price $2,161.60 CAD
Regular price Sale price $2,161.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9M2C0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESNNNNLNLDMEKDQETTFDYSKRAQWLRAAVLGANDGLVSTASLMMGIGAVKQDVRIM LLTGFAGLVAGACSMAIGEFISVYSQYDIEVAQMKRESGGETKKEKLPSPTQAAIASALA FTLGAIVPLLAAAFVKEYKVRIGVIVAAVTLALVMFGWLGAVLGKAPVVKSLVRVLIGGW LAMAITFGFTKLVGSHGL

Protein Names:Recommended name: Vacuolar iron transporter homolog 4 Alternative name(s): Protein NODULIN-LIKE 4

Gene Names:Ordered Locus Names:At3g43660 ORF Names:F23N14.40

Expression Region:1-198

Sequence Info:full length protein

View full details