Gene Bio Systems
Recombinant Arabidopsis thaliana UPF0136 membrane protein At2g26240 (At2g26240)
Recombinant Arabidopsis thaliana UPF0136 membrane protein At2g26240 (At2g26240)
SKU:CSB-CF524640DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:O64847
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDSSLSQKFTLAYASLLGVGGLMGYLKRGSKISLVAGGGSAALFYYVYTELPGNPVLASS IGIVGSAALTGMMGSRYLRTRKVVPAGLVSVVSLVMTGAYLHGLIRSS
Protein Names:Recommended name: UPF0136 membrane protein At2g26240
Gene Names:Ordered Locus Names:At2g26240 ORF Names:T1D16.12
Expression Region:1-108
Sequence Info:full length protein
