Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana UPF0057 membrane protein At4g30650(At4g30650)

Recombinant Arabidopsis thaliana UPF0057 membrane protein At4g30650(At4g30650)

SKU:CSB-CF885501DOA

Regular price $1,976.80 CAD
Regular price Sale price $1,976.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9M095

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASNMEVFCEILIAILLPPLGVCLKRGCCTVEFLICLVLTILGYIPGIIYALYVIVFQNR EGSTELGAPLNSA

Protein Names:Recommended name: UPF0057 membrane protein At4g30650

Gene Names:Ordered Locus Names:At4g30650

Expression Region:1-73

Sequence Info:full length protein

View full details