Gene Bio Systems
Recombinant Arabidopsis thaliana Uncharacterized protein At5g65660(At5g65660)
Recombinant Arabidopsis thaliana Uncharacterized protein At5g65660(At5g65660)
SKU:CSB-CF862870DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9LSK9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MENTQDFSPPHMDASRPSLGFPLGTALLLIIIFSLSGIFSCCYHWDKHRSLRRSLANGRP SADIESNPYKPKPPFPEMKKPQNLSVPVLMPGDNTPKFIALPCPCAPPRPEKLTVDVQTP PQSPPVKPARFPVPLY
Protein Names:Recommended name: Uncharacterized protein At5g65660
Gene Names:Ordered Locus Names:At5g65660 ORF Names:K21L13.18
Expression Region:1-136
Sequence Info:full length protein
