Gene Bio Systems
Recombinant Arabidopsis thaliana RING-H2 finger protein ATL74(ATL74)
Recombinant Arabidopsis thaliana RING-H2 finger protein ATL74(ATL74)
SKU:CSB-CF878650DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9LZV8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHRLLLESHGGGNETSGSGGGDGYTRDMNFDANMVIILAALLCALILALGLNSILRCAMR CGFGLSSSAAAGTVADRAGLKKRELKKFPVAEYGSGEVKIAATECAICLGEFADGERVRV LPPCNHSFHMSCIDTWLVSHSSCPNCRHSLIEVHVAGSE
Protein Names:Recommended name: RING-H2 finger protein ATL74
Gene Names:Name:ATL74 Ordered Locus Names:At5g01880 ORF Names:T20L15_150
Expression Region:1-159
Sequence Info:full length protein
