Gene Bio Systems
Recombinant Arabidopsis thaliana RING-H2 finger protein ATL18(ATL18)
Recombinant Arabidopsis thaliana RING-H2 finger protein ATL18(ATL18)
SKU:CSB-CF871219DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9SZL4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:KKNGGDADAHDDDGYNLVGVMFGDKEKEEEICCPICLVEFEAEDAVTHLPRCAHLFHINC IEPWLLRGHLTCPLCRSFVLAPTPPTQNVNNAHSSSTLYLSIFFFFCIFLHLLGYL
Protein Names:Recommended name: RING-H2 finger protein ATL18
Gene Names:Name:ATL18 Ordered Locus Names:At4g38140 ORF Names:F20D10.260
Expression Region:30-145
Sequence Info:full length protein
