Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Reticulon-like protein B23(RTNLB23)

Recombinant Arabidopsis thaliana Reticulon-like protein B23(RTNLB23)

SKU:CSB-CF317507DOA

Regular price $2,098.60 CAD
Regular price Sale price $2,098.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P0C941

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGEMGKAIGLLISGTLVYHHCANRNATLLSLISDVLIVLLSSLAILGLLFRHLNVSVPVD PLEWQISQDTACNIVARLANTVGAAESVLRVAATGHDKRLFVKVVICLYFLAALGRIISG VTIAYAGLCLFCLSMLFRSSIRNSVLNRRNGEILD

Protein Names:Recommended name: Reticulon-like protein B23 Short name= AtRTNLB23

Gene Names:Name:RTNLB23 Ordered Locus Names:At1g16825 ORF Names:F17F16.24

Expression Region:1-155

Sequence Info:full length protein

View full details