Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Putative cytochrome c oxidase subunit 5C-4(At5g40382)

Recombinant Arabidopsis thaliana Putative cytochrome c oxidase subunit 5C-4(At5g40382)

SKU:CSB-CF872300DOA

Regular price $1,965.60 CAD
Regular price Sale price $1,965.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FNE0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANVQKIGKAVYKGPSVVKEIIYGITLGFAVGGLWKMHHWNNQRRTKEFYDLLEKGEISV VVEDE

Protein Names:Recommended name: Putative cytochrome c oxidase subunit 5C-4 Alternative name(s): Cytochrome c oxidase polypeptide Vc-4

Gene Names:Ordered Locus Names:At5g40382 ORF Names:MPO12.11

Expression Region:1-65

Sequence Info:full length protein

View full details