Gene Bio Systems
Recombinant Arabidopsis thaliana Protein TIC 20-II, chloroplastic(TIC20-II)
Recombinant Arabidopsis thaliana Protein TIC 20-II, chloroplastic(TIC20-II)
SKU:CSB-CF526861DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:O82251
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ASYTPTPATERVISIASYALPFFNSLQYGRFLFAQYPRLGLLFEPIFPILNLYRSVPYAS FVAFFGLYLGVVRNTSFSRYVRFNAMQAVTLDVLLAVPVLLTRILDPGQGGGFGMKAMMW GHTGVFVFSFMCFVYGVVSSLLGKTPYIPFVADAAGRQL
Protein Names:Recommended name: Protein TIC 20-II, chloroplastic Alternative name(s): Tanslocon at the inner envelope membrane of chloroplasts 20-II Short name= AtTIC20-II
Gene Names:Name:TIC20-II Ordered Locus Names:At2g47840 ORF Names:F17A22.23
Expression Region:50-208
Sequence Info:full length protein
