Gene Bio Systems
Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 12(PCR12)
Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 12(PCR12)
SKU:CSB-CF890464DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9SX26
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYGNGPVFKAEGTSFRDQPYAEQLPQGLWTTGLCDCHEDAHICVQTAIMPCVSFAQNVEI VNRGTIPCMNAGLIHLALGFIGCSWLYAFPNRSRLREHFALPEEPCRDFLVHLFCTPCAI CQESRELKNRGADPSIGWLSNVEKWSREKVTPPIVVPGMIR
Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 12 Short name= AtPCR12
Gene Names:Name:PCR12 Ordered Locus Names:At1g68630 ORF Names:F24J5.13
Expression Region:1-161
Sequence Info:full length protein
