Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein cornichon homolog 1(At3g12180)

Recombinant Arabidopsis thaliana Protein cornichon homolog 1(At3g12180)

SKU:CSB-CF866384DOA

Regular price $2,084.60 CAD
Regular price Sale price $2,084.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9C7D7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAWDLFLWIVSFFVSLALVASVFYQVICLTDLEADYLNPFETSTRINRLVIPEFILQGSL CLLFLLTWHWVFFLVAVPVTVYHAMLYKERRYLIDVTEVFRGISFEKKLRYTKLGFYVFL FIMVVFRLTLSAVYSFTEDDDLLHLF

Protein Names:Recommended name: Protein cornichon homolog 1

Gene Names:Ordered Locus Names:At3g12180 ORF Names:F28J15.3

Expression Region:1-146

Sequence Info:full length protein

View full details