Gene Bio Systems
Recombinant Arabidopsis thaliana Probable signal peptidase complex subunit 2 (At2g39960)
Recombinant Arabidopsis thaliana Probable signal peptidase complex subunit 2 (At2g39960)
SKU:CSB-CF348323DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:P58684
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEEKKTESTNKNVKKANLLDHHSIKHILDESVSDIVTSRGYKEDVRLSNLKLILGTIIIV VALVAQFYNKKFPENRDFLIGCIALYVVLNAVLQLILYTKEKNAILFTYPPEGSFTSTGL VVSSKLPRFSDQYTLTIDSADPKSISAGKSVQLTKSVTQWFTKDGVLVEGLFWKDVEALI KNYAEEEPKKKK
Protein Names:Recommended name: Probable signal peptidase complex subunit 2 EC= 3.4.-.- Alternative name(s): Microsomal signal peptidase 25 kDa subunit Short name= SPase 25 kDa subunit
Gene Names:Ordered Locus Names:At2g39960 ORF Names:T28M21.12
Expression Region:1-192
Sequence Info:full length protein
