Gene Bio Systems
Recombinant Arabidopsis thaliana Probable gamma-secretase subunit PEN-2(At5g09310)
Recombinant Arabidopsis thaliana Probable gamma-secretase subunit PEN-2(At5g09310)
SKU:CSB-CF872341DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9FY84
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEATRSDDPSLNPIRNRNPNPNPNPNPLSTIISSAQVWPTIDGPLGLTEEASVDYARRFY KFGFALLPWLWFVNCFYFWPVLRHSRAFPQIRNYVVRSAIGFSVFTALLSAWALTFSIGG EQLFGPLYDKLVMYNVADRLGLSGLA
Protein Names:Recommended name: Probable gamma-secretase subunit PEN-2
Gene Names:Ordered Locus Names:At5g09310 ORF Names:T5E8.110
Expression Region:1-146
Sequence Info:full length protein
