Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Probable aquaporin SIP2-1(SIP2-1)

Recombinant Arabidopsis thaliana Probable aquaporin SIP2-1(SIP2-1)

SKU:CSB-CF862965DOA

Regular price $2,219.00 CAD
Regular price Sale price $2,219.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9M1K3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGRIGLVVTDLVLSFMWIWAGVLVNILVHGVLGFSRTDPSGEIVRYLFSIISMFIFAYLQ QATKGGLYNPLTALAAGVSGGFSSFIFSVFVRIPVEVIGSILAVKHIIHVFPEIGKGPKL NVAIHHGALTEGILTFFIVLLSMGLTRKIPGSFFMKTWIGSLAKLTLHILGSDLTGGCMN PAAVMGWAYARGEHITKEHLLVYWLGPVKATLLAVWFFKVVFKPLTEEQEKPKAKSE

Protein Names:Recommended name: Probable aquaporin SIP2-1 Alternative name(s): Small basic intrinsic protein 2-1 Short name= AtSIP2;1

Gene Names:Name:SIP2-1 Ordered Locus Names:At3g56950 ORF Names:F24I3.30

Expression Region:1-237

Sequence Info:full length protein

View full details