Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana PRA1 family protein G2(PRA1G2)

Recombinant Arabidopsis thaliana PRA1 family protein G2(PRA1G2)

SKU:CSB-CF875446DOA

Regular price $2,143.40 CAD
Regular price Sale price $2,143.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FH16

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTPSPPPITYISIPLPTNDVVSRSIHNLTTAISSHRPWSELIFSGDFSLPESFSSLLLRS KTNFNYFFVNYTIIVSTCAAFALITASPVALIVVGAIIALWLIFHFFREDPLILWSFQVG DRTVLLFLVLASVWAIWFTNSAVNLAVGVSVGLLLCIIHAVFRNSDELFLEEDDAINGGL IGSNLR

Protein Names:Recommended name: PRA1 family protein G2 Short name= AtPRA1.G2

Gene Names:Name:PRA1G2 Ordered Locus Names:At5g56230 ORF Names:K24C1.4

Expression Region:1-186

Sequence Info:full length protein

View full details