Gene Bio Systems
Recombinant Arabidopsis thaliana PRA1 family protein F1(PRA1F1)
Recombinant Arabidopsis thaliana PRA1 family protein F1(PRA1F1)
SKU:CSB-CF884355DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9FZ63
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTTYGTNQKSSNDLAPKLEYITRGINQHKRSGLATRRPWKQMLDLGSFNFPRKLATVITR IRANTVYFQTNYTIVVLFSVFLSLIWNPFSLLVLLALLGAWLFLYFLRDEPLTVFDREID HRIVLIIMSVITLSILFLTDAKLNIAVAIVAGALAVLSHAAVRKTEDLFQTDEETSLLNP
Protein Names:Recommended name: PRA1 family protein F1 Short name= AtPRA1.F1
Gene Names:Name:PRA1F1 Ordered Locus Names:At1g17700 ORF Names:F11A6.4
Expression Region:1-180
Sequence Info:full length protein
