Gene Bio Systems
Recombinant Arabidopsis thaliana PRA1 family protein D(PRA1D)
Recombinant Arabidopsis thaliana PRA1 family protein D(PRA1D)
SKU:CSB-CF309770DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:P93829
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MANQVITGIKETAQSITGAARPWGDFLDLSAFSFPSSIADATTRVTQNLTHFRINYSIIL SILLGLTLITRPIAILAFIAVGLAWFFLYFAREEPLTIFGFTIDDGIVAVLLIGLSIGSL VTTGVWLRALTTVGFGVLVLILHAALRGTDDLVSDDLESPYGPMLSTSGGGNDGARGDYS GI
Protein Names:Recommended name: PRA1 family protein D Short name= AtPRA1.D Alternative name(s): CAMV MOVEMENT PROTEIN-INTERACTING PROTEIN 7 Prenylated Rab acceptor 5
Gene Names:Name:PRA1D Synonyms:MPI7, MPIP7, PRA5 Ordered Locus Names:At1g04260 ORF Names:F19P19.30
Expression Region:1-182
Sequence Info:full length protein
