Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana PRA1 family protein B6(PRA1B6)

Recombinant Arabidopsis thaliana PRA1 family protein B6(PRA1B6)

SKU:CSB-CF868075DOA

Regular price $2,188.20 CAD
Regular price Sale price $2,188.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LYQ4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASPLLPTSTTPDQLPGGDPQLLSSLRVLLSRVLATVRHASADARPWAELVDRSAFSRPP SLSEATSRVRKNFSYFRANYITLVAILLAASLLTHPFALFLLASLAASWLFLYFFRPADQ PLVIGGRTFSDLETLGILCLSTVVVMFMTSVGSLLMSTLAVGIMGVAIHGAFRAPEDLFL EEQEAIGSGLFAFFNNNASNAAAAAIATSAMSRVRV

Protein Names:Recommended name: PRA1 family protein B6 Short name= AtPRA1.B6 Alternative name(s): Prenylated Rab acceptor 3

Gene Names:Name:PRA1B6 Synonyms:PRA3 Ordered Locus Names:At5g07110 ORF Names:T28J14.50

Expression Region:1-216

Sequence Info:full length protein

View full details