Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana PRA1 family protein B3(PRA1B3)

Recombinant Arabidopsis thaliana PRA1 family protein B3(PRA1B3)

SKU:CSB-CF880783DOA

Regular price $2,189.60 CAD
Regular price Sale price $2,189.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FLB6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMANPPTLPISDHSGGGSQSQQPVSTPAFRTFLSRLSSSIRQSLSQRRPWLELVDRSAIS RPESLTDAYSRIRRNLPYFKVNYVTIVSLVLALSLLSHPFSLLVLLCLFCAWIFLYLFRP SDQPLVVLGRTFSDRETLGVLVILTIVVVFLTSVGSLLTSALMIGFGIVCLHGAFRVPED LFLDDQEPANTGLLSFLSGAATSAAVAAASTPASGRV

Protein Names:Recommended name: PRA1 family protein B3 Short name= AtPRA1.B3 Alternative name(s): Prenylated Rab acceptor 2

Gene Names:Name:PRA1B3 Synonyms:PRA2 Ordered Locus Names:At5g05380 ORF Names:K18I23.19

Expression Region:1-217

Sequence Info:full length protein

View full details