Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Photosystem II 22 kDa protein, chloroplastic(PSBS)

Recombinant Arabidopsis thaliana Photosystem II 22 kDa protein, chloroplastic(PSBS)

SKU:CSB-CF894502DOA

Regular price $2,172.80 CAD
Regular price Sale price $2,172.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9XF91

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AAPKKVEKPKSKVEDGIFGTSGGIGFTKANELFVGRVAMIGFAASLLGEALTGKGILAQL NLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGKFVDDPPTGLEKAVIPPGKNVRSALG LKEQGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGIPIQDIEPLVL LNVAFFFFAAINPGNGKFITDDGEES

Protein Names:Recommended name: Photosystem II 22 kDa protein, chloroplastic Alternative name(s): CP22

Gene Names:Name:PSBS Ordered Locus Names:At1g44575 ORF Names:T18F15.3

Expression Region:60-265

Sequence Info:full length protein

View full details