Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Photosystem I reaction center subunit VI-2, chloroplastic(PSAH2)

Recombinant Arabidopsis thaliana Photosystem I reaction center subunit VI-2, chloroplastic(PSAH2)

SKU:CSB-CF865986DOA

Regular price $2,009.00 CAD
Regular price Sale price $2,009.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SUI6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KYGDKSVYFDLEDLGNTTGQWDVYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILG GGSLLTYVSANSTGDVLPIKRGPQEPPKLGPRGKL

Protein Names:Recommended name: Photosystem I reaction center subunit VI-2, chloroplastic Alternative name(s): PSI-H1

Gene Names:Name:PSAH2 Ordered Locus Names:At1g52230 ORF Names:F9I5.11

Expression Region:51-145

Sequence Info:full length protein

View full details