Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9SUI5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DFIGSSTNLIMVTSTTLMLFAGRFGLAPSANRKATAGLRLEARDSGLQTGDPAGFTLADT LACGTVGHIIGVGVVLGLKNIGAI
Protein Names:Recommended name: Photosystem I reaction center subunit psaK, chloroplastic Alternative name(s): PSI-K Photosystem I subunit X
Gene Names:Name:PSAK Ordered Locus Names:At1g30380 ORF Names:T4K22.2
Expression Region:47-130
Sequence Info:full length protein