Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Peroxisomal membrane protein 11E(PEX11E)

Recombinant Arabidopsis thaliana Peroxisomal membrane protein 11E(PEX11E)

SKU:CSB-CF802903DOA

Regular price $2,210.60 CAD
Regular price Sale price $2,210.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q84JW1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTLDLTRAELALIVLYLNKAEARDKICRAIQYGSKFLSGGQPGTAQTVDKNTSLARKVF RLFKFVNDFHGLISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERTE LLGRISLFCWLGSSVCTSAVEIGELGRLSSSMKKMEKELKADDELYRAKLQKSNDRTLAL IKSSMDIIVAIGLLQLAPKTISPRVTGAFGFTTSLISCYQLLPSRPKLKTP

Protein Names:Recommended name: Peroxisomal membrane protein 11E Alternative name(s): Peroxin-11E Short name= AtPEX11e

Gene Names:Name:PEX11E Synonyms:PEX11-2 Ordered Locus Names:At3g61070 ORF Names:T27I15.160

Expression Region:1-231

Sequence Info:full length protein

View full details