Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Outer envelope pore protein 16-3, chloroplastic-mitochondrial(OEP163)

Recombinant Arabidopsis thaliana Outer envelope pore protein 16-3, chloroplastic-mitochondrial(OEP163)

SKU:CSB-CF524325DOA

Regular price $2,104.20 CAD
Regular price Sale price $2,104.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O48528

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDPAEMRYLEEEDGPLMKTIKGSITGFGAGTIYGTILATWKDVPRVERNVALPGLIRTLK MMGTHGLTFAAIGGVYIGVEQLVQNFRSKRDFYNGAIGGFVAGASVLGYRARSIPTAIAA GATLAVTSALIDSGGQTTRVDNGREYYPYTVEKRAEADS

Protein Names:Recommended name: Outer envelope pore protein 16-3, chloroplastic/mitochondrial Alternative name(s): Chloroplastic outer envelope pore protein of 16 kDa 3 Short name= AtOEP16-3 Short name= OEP16-3

Gene Names:Name:OEP163 Ordered Locus Names:At2g42210 ORF Names:T24P15.12

Expression Region:1-159

Sequence Info:full length protein

View full details