
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q93ZH2
Gene Names: NFYA3
Organism: Arabidopsis thaliana (Mouse-ear cress)
AA Sequence: MMHQMLNKKDSATHSTLPYLNTSISWGVVPTDSVANRRGSAESLSLKVDSRPGHIQTTKQISFQDQDSSSTQSTGQSYTEVASSGDDNPSRQISFSAKSGSEITQRKGFASNPKQGSMTGFPNIHFAPAQANFSFHYADPHYGGLLAATYLPQAPTCNPQMVSMIPGRVPLPAELTETDPVFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKPYLHESRHVHALKRPRGSGGRFLNTKKLLQESEQAAAREQEQDKLGQQVNRKTNMSRFEAHMLQNNKDRSSTTSGSDITSVSDGADIFGHTEFQFSGFPTPINRAMLVHGQSNDMHGGGDMHHFSVHI
Expression Region: 1-340aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 41.6 kDa
Alternative Name(s): Transcriptional activator HAP2;C
Relevance: Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Reference: Multiple genes encoding the conserved CCAAT-box transcription factor complex are expressed in Arabidopsis.Edwards D., Murray J.A.H., Smith A.G.Plant Physiol. 117:1015-1022(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.