Gene Bio Systems
Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial(At5g47570)
Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial(At5g47570)
SKU:CSB-CF861779DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9FGK0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:RAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALAWLSGGLGFF VGLGLLAVLNDKASKVPFTPRVYPYDNLRVELGGEP
Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
Gene Names:Ordered Locus Names:At5g47570 ORF Names:MNJ7.16
Expression Region:30-125
Sequence Info:full length protein
![Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial(At5g47570)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_beb18247-5649-4975-842b-8804de4f23d3.jpg?v=1659249325&width=1445)