Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Membrane steroid-binding protein 1(MSBP1)

Recombinant Arabidopsis thaliana Membrane steroid-binding protein 1(MSBP1)

SKU:CSB-CF894030DOA-GB

Regular price $2,193.80 CAD
Regular price Sale price $2,193.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9XFM6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALELWQTLKEAIHAYTGLSPVVFFTALALAFAIYQVISGWFASPFDDVNRHQRARSLAQ EEEPPIPQPVQVGEITEEELKQYDGSDPQKPLLMAIKHQIYDVTQSRMFYGPGGPYALFA GKDASRALAKMSFEEKDLTWDVSGLGPFELDALQDWEYKFMSKYAKVGTVKVAGSEPETA SVSEPTENVEQDAHVTTTPGKTVVDKSDDAPAETVLKKEE

Protein Names:Recommended name: Membrane steroid-binding protein 1 Short name= AtMP1

Gene Names:Name:MSBP1 Synonyms:MP1 Ordered Locus Names:At5g52240 ORF Names:F17P19.14

Expression Region:1-220

Sequence Info:full length protein

View full details