Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana HVA22-like protein f(HVA22F)

Recombinant Arabidopsis thaliana HVA22-like protein f(HVA22F)

SKU:CSB-CF734642DOA

Regular price $2,102.80 CAD
Regular price Sale price $2,102.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q682H0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGFIIAIAKRFDALVGPGVMLLYPLYASFRAIESPTMLDDQQWLTYWIIYSLITIFELSV WRVLAWLPFWPYLKLLFCMWLVLPMFSGAAYIYSNFVRQYVKIGMNVGGGTNYTDEQRRV LQMMSLDARKSVQDYVDRFGWDSVEKAIKAAEKETRKH

Protein Names:Recommended name: HVA22-like protein f Short name= AtHVA22f

Gene Names:Name:HVA22F Ordered Locus Names:At2g42820 ORF Names:F7D19.18

Expression Region:1-158

Sequence Info:full length protein

View full details