Gene Bio Systems
Recombinant Arabidopsis thaliana GRF1-interacting factor 1(GIF1)
Recombinant Arabidopsis thaliana GRF1-interacting factor 1(GIF1)
SKU:CSB-EP781430DOA
Couldn't load pickup availability
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Signal Transduction
Uniprot ID:Q8L8A5
Gene Names:GIF1
Organism:Arabidopsis thaliana (Mouse-ear cress)
AA Sequence:MQQHLMQMQPMMAGYYPSNVTSDHIQQYLDENKSLILKIVESQNSGKLSECAENQARLQRNLMYLAAIADSQPQPPSVHSQYGSAGGGMIQGEGGSHYLQQQQATQQQQMTQQSLMAARSSMLYAQQQQQQQPYATLQHQQLHHSQLGMSSSSGGGGSSGLHILQGEAGGFHDFGRGKPEMGSGGGGEGRGGSSGDGGETLYLKSSDDGN
Expression Region:1-210aa
Sequence Info:Full Length
Source:E.coli
Tag Info:N-terminal 6xHis-KSI-tagged
MW:37.8 kDa
Alternative Name(s):GRF1-interacting factor 1(AtGIF1)(Protein ANGUSTIFOLIA 3)(Transcription coactivator GIF1)
Relevance:Transcription coactivator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation (PubMed:19392710). Appears to function synergistically with GRF1 as a transcriptional coactivator. Acts together with GRF5 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia. Plays a role in adaxial/abaxial patterning and growth in leaf morphogenesis. GIFs are involved in the positive regulation of cell proliferation of lateral organs in a functionally redundant manner. Together with GATA18/HAN, mediates cotyledon identity by preventing ectopic root formation through the repression of PLT1 expression (PubMed:22669825).
Reference:"Stable establishment of cotyledon identity during embryogenesis in Arabidopsis by ANGUSTIFOLIA3 and HANABA TARANU." Kanei M., Horiguchi G., Tsukaya H. Development 139:2436-2446(2012)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:13-23 business days
