Gene Bio Systems
Recombinant Arabidopsis thaliana Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1(DAD1)
Recombinant Arabidopsis thaliana Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1(DAD1)
SKU:CSB-CF654395DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q39080
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVKSTSKDAQDLFRSLRSAYSATPTNLKIIDLYVVFAVFTALIQVVYMALVGSFPFNSFL SGVLSCIGTAVLAVCLRIQVNKENKEFKDLAPERAFADFVLCNLVLHLVIINFLG
Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Short name= Oligosaccharyl transferase subunit DAD1 EC= 2.4.1.119 Alternative name(s): Defender against cell death 1 Short name= AtD
Gene Names:Name:DAD1 Ordered Locus Names:At1g32210 ORF Names:F3C3.14
Expression Region:1-115
Sequence Info:full length protein
