Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9LZQ0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGHKVAHATLKGPSVVKELIIGLTLGLAAGGLWKMHHWNEQRKTRTFYDLLERGEIGVV ASEE
Protein Names:Recommended name: Cytochrome c oxidase subunit 5C-2 Alternative name(s): Cytochrome c oxidase polypeptide Vc-2
Gene Names:Ordered Locus Names:At3g62400 ORF Names:T12C14_100
Expression Region:1-64
Sequence Info:full length protein