Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1(PIS1)

Recombinant Arabidopsis thaliana CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1(PIS1)

SKU:CSB-CF818518DOA

Regular price $2,205.00 CAD
Regular price Sale price $2,205.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8LBA6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKKERPRPEKLSVYLYIPNIVGYMRVLLNCVAFAVCFSNKPLFSVLYFFSFCCDAVDGW VARRFNQVSTFGAVLDMVTDRVSTACLLVILSQIYRPSLVFLSLLALDIASHWLQMYSTF LAGKSSHKDVKDSTSWLFRLYYGNRIFMCYCCVSCEVLYIILLLIAKNQSENLLNVVVAT LTQISPLSFLLALTLFGWSMKQTINVIQMKTAADVCVLYDIEKQQKP

Protein Names:Recommended name: CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 EC= 2.7.8.11 Alternative name(s): Phosphatidylinositol synthase 1 Short name= AtPIS1 Short name= PI synthase 1 Short name= PtdIns synthase 1

Gene Names:Name:PIS1 Ordered Locus Names:At1g68000 ORF Names:T23K23.15

Expression Region:1-227

Sequence Info:full length protein

View full details