Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana CASP-like protein At3g50810 (At3g50810)

Recombinant Arabidopsis thaliana CASP-like protein At3g50810 (At3g50810)

SKU:CSB-CF315519DOA

Regular price $2,097.20 CAD
Regular price Sale price $2,097.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P0CB17

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEHVPGSFGTSASFALRFGQTIFSAASLIFMCFDFDFYDFTTFCYLAMVMAIVTPWSILL ALTDTYSVLVKLLPQELRVLSIVFAGDFVLSFLSLGGACAVASATELLASADGKICDGSL CIQYQVSAALAFLCWFLLLASALFNFWSLPSLYY

Protein Names:Recommended name: CASP-like protein At3g50810

Gene Names:Ordered Locus Names:At3g50810 ORF Names:F18B3.90

Expression Region:1-154

Sequence Info:full length protein

View full details