Gene Bio Systems
Recombinant Arabidopsis thaliana CASP-like protein At2g39530(At2g39530)
Recombinant Arabidopsis thaliana CASP-like protein At2g39530(At2g39530)
SKU:CSB-CF811476DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q8GWD5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAPPPPAPPSVTLRTVLLLLRVLTAAFLLITVVLISTNTVTLEISSTSIKLPFNDVYAYR YMLSAAVIGLVYAVVQLFLTISQFATGKTHPLTYQFDFYGDKVISYLLATGSAAGFGVSK DLKDTYIALIEFDSTDPVDKFFSKGYASASLLLFAFVSLAVLSVFSSLALSKRPVPVS
Protein Names:Recommended name: CASP-like protein At2g39530
Gene Names:Ordered Locus Names:At2g39530 ORF Names:F12L6.19
Expression Region:1-178
Sequence Info:full length protein
