Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Aquaporin NIP2-1(NIP2-1)

Recombinant Arabidopsis thaliana Aquaporin NIP2-1(NIP2-1)

SKU:CSB-CF851901DOA

Regular price $2,294.60 CAD
Regular price Sale price $2,294.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8W037

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDDISVSKSNHGNVVVLNIKASSLADTSLPSNKHESSSPPLLSVHFLQKLLAELVGTYYL IFAGCAAIAVNAQHNHVVTLVGIAVVWGIVIMVLVYCLGHLSAHFNPAVTLALASSQRFP LNQVPAYITVQVIGSTLASATLRLLFDLNNDVCSKKHDVFLGSSPSGSDLQAFVMEFIIT GFLMLVVCAVTTTKRTTEELEGLIIGATVTLNVIFAGEVSGASMNPARSIGPALVWGCYK GIWIYLLAPTLGAVSGALIHKMLPSIQNAEPEFSKTGSSHKRVTDLPL

Protein Names:Recommended name: Aquaporin NIP2-1 Alternative name(s): NOD26-like intrinsic protein 2-1 Short name= AtNIP2;1 Nodulin-26-like major intrinsic protein 4 Short name= NodLikeMip4 Short name= Protein NLM4

Gene Names:Name:NIP2-1 Synonyms:NLM4 Ordered Locus Names:At2g34390 ORF Names:T31E10.27

Expression Region:1-288

Sequence Info:full length protein

View full details